SLC24A4 Antikörper

Produktnummer ABIN635379

Der Kaninchen Polyklonal anti-SLC24A4 Antikörper (ABIN635379) detektiert spezifisch SLC24A4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLC24A4 Antikörper (ABIN635379)

Target: SLC24A4 (Slc24a4) (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 4 (Slc24a4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC24A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC24A4 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC24 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC24A4 Blocking Peptide, (ABIN5616207), is also available for use as a blocking control in assays to test for specificity of this SLC24A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC24A4

Target: SLC24A4 (Slc24a4) (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 4 (Slc24a4))

Andere Bezeichnung: SLC24A4

Hintergrund: Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions.

Molekulargewicht: 65 kDa (MW of target protein)