SLC12A8 Antikörper

Produktnummer ABIN635376

Der Kaninchen Polyklonal anti-SLC12A8 Antikörper (ABIN635376) detektiert spezifisch SLC12A8 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLC12A8 Antikörper (ABIN635376)

Target: SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC12A8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC12A8 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC12 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC12A8 Blocking Peptide, (ABIN939392), is also available for use as a blocking control in assays to test for specificity of this SLC12A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC12A8

Target: SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))

Andere Bezeichnung: SLC12A8

Hintergrund: SLC12A8 is a cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.

Molekulargewicht: 78 kDa (MW of target protein)