SLC16A6 Antikörper

Produktnummer ABIN635370

Der Kaninchen Polyklonal anti-SLC16A6 Antikörper (ABIN635370) detektiert spezifisch SLC16A6 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLC16A6 Antikörper (ABIN635370)

Target: SLC16A6 (Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC16A6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC16A6 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC16 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC16A6 Blocking Peptide, (ABIN939435), is also available for use as a blocking control in assays to test for specificity of this SLC16A6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC16A6

Target: SLC16A6 (Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6))

Andere Bezeichnung: SLC16A6

Hintergrund: SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Molekulargewicht: 57 kDa (MW of target protein)