SLC27A6 Antikörper

Produktnummer ABIN635364

Der Kaninchen Polyklonal anti-SLC27A6 Antikörper (ABIN635364) detektiert spezifisch SLC27A6 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für SLC27A6 Antikörper (ABIN635364)

Target: SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC27A6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC27A6 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC27 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC27A6 Blocking Peptide, (ABIN940051), is also available for use as a blocking control in assays to test for specificity of this SLC27A6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC27A6

Target: SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))

Andere Bezeichnung: SLC27A6

Hintergrund: SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 70 kDa (MW of target protein)