SLC5A5 Antikörper

Produktnummer ABIN635336

Der Kaninchen Polyklonal anti-SLC5A5 Antikörper wird verwendet zum Nachweis von SLC5A5 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SLC5A5 Antikörper (ABIN635336)

Target: SLC5A5 (Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC5A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC5A5 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC5 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC5A5 Blocking Peptide, (ABIN5616269), is also available for use as a blocking control in assays to test for specificity of this SLC5A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC5A5

Target: SLC5A5 (Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5))

Andere Bezeichnung: SLC5A5

Hintergrund: The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.

Molekulargewicht: 69 kDa (MW of target protein)