EBP Antikörper

Produktnummer ABIN635262

Der Kaninchen Polyklonal anti-EBP Antikörper (ABIN635262) detektiert spezifisch EBP in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für EBP Antikörper (ABIN635262)

Target: EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EBP Antikörper

Aufreinigung: Affinity purified

Immunogen: EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EBP Blocking Peptide, (ABIN5613293), is also available for use as a blocking control in assays to test for specificity of this EBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EBP

Target: EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))

Andere Bezeichnung: EBP

Hintergrund: EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues.

Molekulargewicht: 26 kDa (MW of target protein)