ANKH Antikörper

Produktnummer ABIN635227

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ANKH in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ANKH Antikörper (ABIN635227)

Target: ANKH (Ankylosis, Progressive Homolog (Mouse) (ANKH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANKH Antikörper

Aufreinigung: Affinity purified

Immunogen: ANKH antibody was raised using a synthetic peptide corresponding to a region with amino acids SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKH Blocking Peptide, (ABIN5612060), is also available for use as a blocking control in assays to test for specificity of this ANKH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKH

Target: ANKH (Ankylosis, Progressive Homolog (Mouse) (ANKH))

Andere Bezeichnung: ANKH

Hintergrund: ANKH regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.

Molekulargewicht: 54 kDa (MW of target protein)