SLC12A3 Antikörper

Produktnummer ABIN635178

Der Kaninchen Polyklonal anti-SLC12A3 Antikörper (ABIN635178) detektiert spezifisch SLC12A3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLC12A3 Antikörper (ABIN635178)

Target: SLC12A3 (Solute Carrier Family 12 (Sodium/Chloride Transporters), Member 3 (SLC12A3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC12A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC12A3 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC12 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC12A3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC12A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC12A3

Target: SLC12A3 (Solute Carrier Family 12 (Sodium/Chloride Transporters), Member 3 (SLC12A3))

Andere Bezeichnung: SLC12A3

Hintergrund: This gene encodes a renal thiazide-sensitive sodium-chloride cotransporter that is important for electrolyte homeostasis. This cotransporter mediates sodium and chloride reabsorption in the distal convoluted tubule.

Molekulargewicht: 114 kDa (MW of target protein)