Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) Antikörper

Produktnummer ABIN635159

Der Kaninchen Polyklonal anti-Solute Carrier Organic Anion Transporter Family, Member 3A1 Antikörper wird verwendet zum Nachweis von Solute Carrier Organic Anion Transporter Family, Member 3A1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) Antikörper (ABIN635159)

Target: Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: Middle Region

Spezifität: SLCO3 A1 antibody was raised against the middle region of SLCO3 1

Aufreinigung: Affinity purified

Immunogen: SLCO3 A1 antibody was raised using the middle region of SLCO3 1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLCO3A1 Blocking Peptide, (ABIN5616286), is also available for use as a blocking control in assays to test for specificity of this SLCO3A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)

Andere Bezeichnung: SLCO3A1

Hintergrund: SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.

Molekulargewicht: 76 kDa (MW of target protein)