Slc6a14 Antikörper

Produktnummer ABIN635141

Der Kaninchen Polyklonal anti-Slc6a14 Antikörper wird verwendet zum Nachweis von Slc6a14 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Slc6a14 Antikörper (ABIN635141)

Target: Slc6a14 (Solute Carrier Family 6 (Amino Acid Transporter), Member 14 (Slc6a14))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Slc6a14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Slc6a14 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC6 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC6A14 Blocking Peptide, (ABIN5616271), is also available for use as a blocking control in assays to test for specificity of this SLC6A14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Slc6a14

Target: Slc6a14 (Solute Carrier Family 6 (Amino Acid Transporter), Member 14 (Slc6a14))

Andere Bezeichnung: SLC6A14

Hintergrund: This gene encodes a member of the solute carrier family 6. Members of this family are sodium and chloride dependent neurotransmitter transporters. The encoded protein transports both neutral and cationic amino acids.

Molekulargewicht: 72 kDa (MW of target protein)