SLCO1A2 Antikörper (Middle Region)

Produktnummer ABIN635140

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLCO1A2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLCO1A2 Antikörper (Middle Region) (ABIN635140)

Target: SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLCO1A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLCO1A2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLCO1 A2 antibody was raised against the middle region of SLCO1 2

Aufreinigung: Affinity purified

Immunogen: SLCO1 A2 antibody was raised using the middle region of SLCO1 2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLCO1A2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLCO1A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLCO1A2

Target: SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))

Andere Bezeichnung: SLCO1A2

Hintergrund: SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.

Molekulargewicht: 64 kDa (MW of target protein)