SLC6A5 Antikörper

Produktnummer ABIN635139

Der Kaninchen Polyklonal anti-SLC6A5 Antikörper (ABIN635139) detektiert spezifisch SLC6A5 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLC6A5 Antikörper (ABIN635139)

Target: SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC6A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC6A5 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC6 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC6A5 Blocking Peptide, (ABIN940454), is also available for use as a blocking control in assays to test for specificity of this SLC6A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC6A5

Target: SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))

Andere Bezeichnung: SLC6A5

Hintergrund: This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission.

Molekulargewicht: 87 kDa (MW of target protein)