SLCO1C1 Antikörper (N-Term)

Produktnummer ABIN635126

Es gibt 1 Publikation für dieses Produkt. Der Kaninchen Polyklonal anti-SLCO1C1 Antikörper wird verwendet zum Nachweis von SLCO1C1 in Proben von Human, Ratte und Maus. Er wurde validiert für WB.

Kurzübersicht für SLCO1C1 Antikörper (N-Term) (ABIN635126)

Target: SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLCO1C1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLCO1C1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLCO1 C1 antibody was raised against the N terminal of SLCO1 1

Aufreinigung: Affinity purified

Immunogen: SLCO1 C1 antibody was raised using the N terminal of SLCO1 1 corresponding to a region with amino acids VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLCO1C1 Blocking Peptide, (ABIN5616285), is also available for use as a blocking control in assays to test for specificity of this SLCO1C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-SLCO1C1 Antikörper (ABIN635126)

Szczupak, Peña, Bracho, Mei, Bas, Fernandez-Valle, Liu, Telischi, Ivan, Dinh: "Fluorescent Detection of Vestibular Schwannoma Using Intravenous Sodium Fluorescein In Vivo." in: Otology & neurotology : official publication of the American Otological Society, American Neurotology Society [and] European Academy of Otology and Neurotology, Vol. 42, Issue 4, pp. e503-e511, (2021) (PubMed).

Details zu SLCO1C1

Target: SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))

Andere Bezeichnung: SLCO1C1

Hintergrund: SLCO1C1 is a member of the organic anion transporter family. SLCO1C1 is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyroid hormones thyroxine, tri-iodothyronine and reverse tri-iodothyronine. Polymorphisms in the gene encoding this protein may be associated with fatigue and depression in patients suffering from hyperthyroidism.

Molekulargewicht: 79 kDa (MW of target protein)