Slc25a1 Antikörper

Produktnummer ABIN635081

Der Kaninchen Polyklonal anti-Slc25a1 Antikörper wird verwendet zum Nachweis von Slc25a1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Slc25a1 Antikörper (ABIN635081)

Target: Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Slc25a1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Slc25a1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC25 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A1 Blocking Peptide, (ABIN5616209), is also available for use as a blocking control in assays to test for specificity of this SLC25A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Slc25a1

Target: Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))

Andere Bezeichnung: SLC25A1

Hintergrund: The mitochondrial tricarboxylate transporter (also called citrate transport protein, or CTP) is responsible for the movement of citrate across the mitochondrial inner membrane.

Molekulargewicht: 34 kDa (MW of target protein)