SLC25A4 Antikörper

Produktnummer ABIN635077

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC25A4 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLC25A4 Antikörper (ABIN635077)

Target: SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC25A4 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC25 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A4 Blocking Peptide, (ABIN5616226), is also available for use as a blocking control in assays to test for specificity of this SLC25A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A4

Target: SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))

Andere Bezeichnung: SLC25A4

Hintergrund: This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Proton Transport, Dicarboxylic Acid Transport