SLC25A16 Antikörper

Produktnummer ABIN635072

Der Kaninchen Polyklonal anti-SLC25A16 Antikörper wird verwendet zum Nachweis von SLC25A16 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für SLC25A16 Antikörper (ABIN635072)

Target: SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC25A16 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC25 A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A16 Blocking Peptide, (ABIN5616211), is also available for use as a blocking control in assays to test for specificity of this SLC25A16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A16

Target: SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))

Andere Bezeichnung: SLC25A16

Hintergrund: SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.

Molekulargewicht: 36 kDa (MW of target protein)