SLC25A24 Antikörper

Produktnummer ABIN635041

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC25A24 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLC25A24 Antikörper (ABIN635041)

Target: SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC25A24 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC25 A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A24 Blocking Peptide, (ABIN5616216), is also available for use as a blocking control in assays to test for specificity of this SLC25A24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A24

Target: SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))

Andere Bezeichnung: SLC25A24

Hintergrund: SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger.

Molekulargewicht: 51 kDa (MW of target protein)