FAM19A3 Antikörper (Middle Region)

Produktnummer ABIN634975

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch FAM19A3 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für FAM19A3 Antikörper (Middle Region) (ABIN634975)

Target: FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM19A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM19A3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM19 A3 antibody was raised against the middle region of FAM19 3

Aufreinigung: Affinity purified

Immunogen: FAM19 A3 antibody was raised using the middle region of FAM19 3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM19A3 Blocking Peptide, (ABIN938444), is also available for use as a blocking control in assays to test for specificity of this FAM19A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM19A3

Target: FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))

Andere Bezeichnung: FAM19A3

Hintergrund: FAM19A3 is a member of the TAFA family which is composed of five highly homologous small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.

Molekulargewicht: 18 kDa (MW of target protein)