B3GALNT1 Antikörper

Produktnummer ABIN634919

Der Kaninchen Polyklonal anti-B3GALNT1 Antikörper wird verwendet zum Nachweis von B3GALNT1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für B3GALNT1 Antikörper (ABIN634919)

Target: B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B3GALNT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-B3GALNT1 Antikörper

Aufreinigung: Affinity purified

Immunogen: B3 GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B3GALNT1 Blocking Peptide, (ABIN5612253), is also available for use as a blocking control in assays to test for specificity of this B3GALNT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B3GALNT1

Target: B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))

Andere Bezeichnung: B3GALNT1

Hintergrund: This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates.

Molekulargewicht: 39 kDa (MW of target protein)