DPP6 Antikörper

Antigen: DPP6

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN634901

Produktbeschreibung

Immunogen: DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ

Beschreibung: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.

Molekulargewicht: 91 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPP6 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.