SLC36A2 Antikörper

Produktnummer ABIN634894

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC36A2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLC36A2 Antikörper (ABIN634894)

Target: SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 2 (SLC36A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC36A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC36A2 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC36 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC36A2 Blocking Peptide, (ABIN5616242), is also available for use as a blocking control in assays to test for specificity of this SLC36A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC36A2

Target: SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 2 (SLC36A2))

Andere Bezeichnung: SLC36A2

Hintergrund: SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Proton Transport