Amyloid beta (A4) Precursor Protein (APP) Antikörper

Antigen: Amyloid beta (A4) Precursor Protein (APP)

Synonyme: APP, APP-like, APPL, Abeta, BcDNA:GH04413, EG:65F1.5, DmelCG7727, CG7727, AAA, AD1, PN2, ABPP, APPI, CVAP, ABETA, CTFgamma, aaa, ad1, pn2, abpp, appi, cvap, abeta, MGC88882, ctfgamma

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN634769

Produktbeschreibung

Weitere Bezeichnung: APP

Immunogen: APP antibody was raised using the middle region of APP corresponding to a region with amino acids EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAAN

Beschreibung: APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Molekulargewicht: 77 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APP antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Signaltransduktion