BAG3 Antikörper (Middle Region)

Produktnummer ABIN634595

Der Kaninchen Polyklonal anti-BAG3 Antikörper wird verwendet zum Nachweis von BAG3 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für BAG3 Antikörper (Middle Region) (ABIN634595)

Target: BAG3 (BCL2-Associated Athanogene 3 (BAG3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BAG3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BAG3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: BAG3 antibody was raised against the middle region of BAG3

Aufreinigung: Affinity purified

Immunogen: BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BAG3 Blocking Peptide, (ABIN5612272), is also available for use as a blocking control in assays to test for specificity of this BAG3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAG3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BAG3

Target: BAG3 (BCL2-Associated Athanogene 3 (BAG3))

Andere Bezeichnung: BAG3

Hintergrund: BAG3 inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. BAG3 has anti-apoptotic activity.

Molekulargewicht: 61 kDa (MW of target protein)