ADAM Metallopeptidase Domain 33 (ADAM33) Antikörper

Antigen: ADAM Metallopeptidase Domain 33 (ADAM33)

Synonyme: FLJ35308, FLJ36751, MGC71889, C20orf153, DJ964F7.1, MGC149823, DKFZp434K0521, Adaml, ADAM13, ADAM33

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN634549

Produktbeschreibung

Weitere Bezeichnung: ADAM33

Immunogen: ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

Beschreibung: ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.

Molekulargewicht: 62 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM33 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Proteolyse / Ubiquitin, Metalloprotease, Extrazelluläre Matrix, Proteasen