SAA4 Antikörper (Middle Region)

Produktnummer ABIN634497

Der Kaninchen Polyklonal anti-SAA4 Antikörper (ABIN634497) detektiert spezifisch SAA4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SAA4 Antikörper (Middle Region) (ABIN634497)

Target: SAA4 (Serum Amyloid A 4 (SAA4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SAA4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SAA4 antibody was raised against the middle region of SAA4

Aufreinigung: Affinity purified

Immunogen: SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAA4 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SAA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAA4

Target: SAA4 (Serum Amyloid A 4 (SAA4))

Andere Bezeichnung: SAA4

Hintergrund: SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.

Molekulargewicht: 2 kDa (MW of target protein)