OAS2 Antikörper (N-Term)

Produktnummer ABIN634458

Der Kaninchen Polyklonal anti-OAS2 Antikörper (ABIN634458) detektiert spezifisch OAS2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für OAS2 Antikörper (N-Term) (ABIN634458)

Target: OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OAS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OAS2 Antikörper

Bindungsspezifität: N-Term

Spezifität: OAS2 antibody was raised against the N terminal of OAS2

Aufreinigung: Affinity purified

Immunogen: OAS2 antibody was raised using the N terminal of OAS2 corresponding to a region with amino acids DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OAS2 Blocking Peptide, (ABIN937298), is also available for use as a blocking control in assays to test for specificity of this OAS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OAS2

Target: OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))

Andere Bezeichnung: OAS2

Hintergrund: OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.

Molekulargewicht: 79 kDa (MW of target protein)

Pathways: Hepatitis C