CANT1 Antikörper (Middle Region)

Produktnummer ABIN634381

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CANT1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für CANT1 Antikörper (Middle Region) (ABIN634381)

Target: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CANT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CANT1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CANT1 antibody was raised against the middle region of CANT1

Aufreinigung: Affinity purified

Immunogen: CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CANT1 Blocking Peptide, (ABIN5612599), is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CANT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CANT1

Target: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Andere Bezeichnung: CANT1

Hintergrund: CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.

Molekulargewicht: 45 kDa (MW of target protein)