In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) Antikörper

Antigen

Dimethylarginine Dimethylaminohydrolase 1 (DDAH1)

Synonyme DDAH, FLJ21264, FLJ25539, AI987801, AW050362, 2410006N07Rik, 2510015N06Rik, fc30c11, wu:fc30c11, ddah1, MGC69055, DDAH1, MGC165853
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN634364
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung DDAH1
Immunogen DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT
Beschreibung DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
Molekulargewicht 31 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDAH1 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Neurologie

Alternativen

Alternativen zu Antigen "Dimethylarginine Dimethylaminohydrolase 1 (DDAH1)", Typ "Antikörper" finden
Wirte Kaninchen (11), Ziege (6), Maus (3)
Reaktivitäten Human (18), Rind (Kuh) (3), Maus (3), Huhn (2), Ratte (Rattus) (2)
Applikationen Western Blot (WB) (17), ELISA (4), Enzyme Immunoassay (EIA) (4), ELISA (Detektionsantikörper) (3), Dot Blot (Dot) (1), Durchflusszytometrie (FACS) (1), Immunhistochemie (IHC) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1)
Epitope C-Term (3)