CHN1 Antikörper

Produktnummer ABIN634308

Der Kaninchen Polyklonal anti-CHN1 Antikörper (ABIN634308) detektiert spezifisch CHN1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für CHN1 Antikörper (ABIN634308)

Target: CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHN1 Antikörper

Aufreinigung: Affinity purified

Immunogen: CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHN1 Blocking Peptide, (ABIN940114), is also available for use as a blocking control in assays to test for specificity of this CHN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHN1

Target: CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))

Andere Bezeichnung: CHN1

Hintergrund: CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.

Molekulargewicht: 53 kDa (MW of target protein)