CAP1 Antikörper

Produktnummer ABIN634302

Der Kaninchen Polyklonal anti-CAP1 Antikörper (ABIN634302) detektiert spezifisch CAP1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für CAP1 Antikörper (ABIN634302)

Target: CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CAP1 Antikörper

Aufreinigung: Affinity purified

Immunogen: CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAP1 Blocking Peptide, (ABIN939642), is also available for use as a blocking control in assays to test for specificity of this CAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAP1

Target: CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))

Andere Bezeichnung: CAP1

Hintergrund: The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: cAMP Metabolic Process