GNAI2 Antikörper

Produktnummer ABIN634285

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GNAI2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für GNAI2 Antikörper (ABIN634285)

Target: GNAI2 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 2 (GNAI2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GNAI2 Antikörper

Aufreinigung: Affinity purified

Immunogen: GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAI2 Blocking Peptide, (ABIN938216), is also available for use as a blocking control in assays to test for specificity of this GNAI2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAI2

Target: GNAI2 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 2 (GNAI2))

Andere Bezeichnung: GNAI2

Hintergrund: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, G-protein mediated Events, Thromboxane A2 Receptor Signaling