ACPP Antikörper (Middle Region)

Produktnummer ABIN634280

Der Kaninchen Polyklonal anti-ACPP Antikörper wird verwendet zum Nachweis von ACPP in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für ACPP Antikörper (Middle Region) (ABIN634280)

Target: ACPP (Acid Phosphatase, Prostate (ACPP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACPP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACPP Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACPP antibody was raised against the middle region of ACPP

Aufreinigung: Affinity purified

Immunogen: ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACPP Blocking Peptide, (ABIN937065), is also available for use as a blocking control in assays to test for specificity of this ACPP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACPP

Target: ACPP (Acid Phosphatase, Prostate (ACPP))

Andere Bezeichnung: ACPP

Hintergrund: This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Synaptic Membrane, Ribonucleoside Biosynthetic Process