SMC2 Antikörper (Middle Region)

Produktnummer ABIN634183

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SMC2 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Ratte.

Kurzübersicht für SMC2 Antikörper (Middle Region) (ABIN634183)

Target: SMC2 (Structural Maintenance of Chromosomes 2 (SMC2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SMC2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SMC2 antibody was raised against the middle region of SMC2

Aufreinigung: Affinity purified

Immunogen: SMC2 antibody was raised using the middle region of SMC2 corresponding to a region with amino acids ATLAGQMMACKNDISKAQTEAKQAQMKLKHAQQELKNKQAEVKKMDSGYR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMC2 Blocking Peptide, (ABIN936949), is also available for use as a blocking control in assays to test for specificity of this SMC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMC2

Target: SMC2 (Structural Maintenance of Chromosomes 2 (SMC2))

Andere Bezeichnung: SMC2

Hintergrund: SMC2 belongs to the SMC family. It is a central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Molekulargewicht: 136 kDa (MW of target protein)