Non-SMC Condensin I Complex, Subunit H (NCAPH) Antikörper

Antigen: Non-SMC Condensin I Complex, Subunit H (NCAPH)

Synonyme: BRRN1, CAP-H, HCAP-H, NCAPH, MGC127159, MGC158618, si:dkeyp-86b9.4

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN634127

Produktbeschreibung

Weitere Bezeichnung: NCAPH

Immunogen: NCAPH antibody was raised using the C terminal of NCAPH corresponding to a region with amino acids TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG

Beschreibung: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Molekulargewicht: 82 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCAPH antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.