In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Non-SMC Condensin I Complex, Subunit H (NCAPH) Antikörper

Antigen

Non-SMC Condensin I Complex, Subunit H (NCAPH)

Synonyme BRRN1, CAP-H, HCAP-H, NCAPH, MGC127159, MGC158618, si:dkeyp-86b9.4
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN634092
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung NCAPH
Immunogen NCAPH antibody was raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL
Beschreibung NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.
Molekulargewicht 82 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCAPH antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternativen

Alternativen zu Antigen "Non-SMC Condensin I Complex, Subunit H (NCAPH)", Typ "Antikörper" finden
Wirte Kaninchen (13), Ziege (5), Maus (3)
Reaktivitäten Human (19), Rind (Kuh) (3), Maus (3), Ratte (Rattus) (3), Schimpanse (1)
Applikationen Western Blot (WB) (19), ELISA (5), Enzyme Immunoassay (EIA) (4), ELISA (Detektionsantikörper) (1), Immunpräzipitation (IP) (1)
Epitope AA 440-457 (1)