In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Cyclin-Dependent Kinase Inhibitor 3 (CDKN3) Antikörper

Antigen

Cyclin-Dependent Kinase Inhibitor 3 (CDKN3)

Synonyme KAP, CDI1, CIP2, KAP1, FLJ25787, MGC70625, CDKN3, MGC133531, 2410006H10Rik
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN634079
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung CDKN3
Immunogen CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG
Beschreibung The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers.
Molekulargewicht 23 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDKN3 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Krebs, Zellzyklus, Kinasen/Phosphatasen

Alternativen

Alternativen zu Antigen "Cyclin-Dependent Kinase Inhibitor 3 (CDKN3)", Typ "Antikörper" finden
Wirte Kaninchen (31), Maus (19)
Reaktivitäten Human (42), Maus (6), Rind (Kuh) (3), Ratte (Rattus) (3), Hund (2), Huhn (1), Schwein (1)
Applikationen Western Blot (WB) (33), Durchflusszytometrie (FACS) (32), Immunfluoreszenz (IF) (24), ELISA (6), Immunhistochemie (Paraffinschnitte) (IHC (p)) (6), Immunhistochemie (IHC) (5), Enzyme Immunoassay (EIA) (4), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (2), Immunpräzipitation (IP) (2), ELISA (Detektionsantikörper) (1), Immunoelectron Microscopy (IEM) (1)
Konjugate Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)
Epitope C-Term (2)