In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1) Antikörper

Antigen

N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1)

Synonyme MGC82286, asah1, MGC173782, zgc:101637, ASAH1, MGC140781, DKFZp469G2224, AC, PHP, ASAH, PHP32, FLJ21558, FLJ22079, Asah, AL022942, AU044555, 2310081N20Rik
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN634057
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung ASAH1
Immunogen ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP
Beschreibung This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally.
Molekulargewicht 14 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASAH1 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Signaltransduktion, Metabolismus

Alternativen

Alternativen zu Antigen "N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1)", Typ "Antikörper" finden
Wirte Kaninchen (7), Maus (6)
Reaktivitäten Human (12), Rind (Kuh) (1), Hund (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (13), Immunhistochemie (Paraffinschnitte) (IHC (p)) (6), ELISA (4), Enzyme Immunoassay (EIA) (3), ELISA (Detektionsantikörper) (1)