CTRP7 Antikörper (Middle Region)

Produktnummer ABIN634045

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CTRP7 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für CTRP7 Antikörper (Middle Region) (ABIN634045)

Target: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CTRP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CTRP7 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C1 QTNF7 antibody was raised against the middle region of C1 TNF7

Aufreinigung: Affinity purified

Immunogen: C1 QTNF7 antibody was raised using the middle region of C1 TNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1QTNF7 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this C1QTNF7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CTRP7

Target: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Andere Bezeichnung: C1QTNF7

Hintergrund: The specific function of C1QTNF7 is not yet known.

Molekulargewicht: 31 kDa (MW of target protein)