PLOD2 Antikörper (Middle Region)

Produktnummer ABIN634011

Der Kaninchen Polyklonal anti-PLOD2 Antikörper (ABIN634011) detektiert spezifisch PLOD2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Ratte.

Kurzübersicht für PLOD2 Antikörper (Middle Region) (ABIN634011)

Target: PLOD2 (Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLOD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLOD2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PLOD2 antibody was raised against the middle region of PLOD2

Aufreinigung: Affinity purified

Immunogen: PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLOD2 Blocking Peptide, (ABIN939405), is also available for use as a blocking control in assays to test for specificity of this PLOD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLOD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLOD2

Target: PLOD2 (Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2))

Andere Bezeichnung: PLOD2

Hintergrund: PLOD2 forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.

Molekulargewicht: 84 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom