In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL) Antikörper

Antigen

3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL)

Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN633970
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung HMGCL
Immunogen HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL
Beschreibung The HMGCL protein belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes the final step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associated with HMG-CoA lyase deficiency.
Molekulargewicht 36 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HMGCL antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Krebs, Metabolismus, Aminosäuren

Alternativen

Alternativen zu Antigen "3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL)", Typ "Antikörper" finden
Wirte Kaninchen (14), Maus (3)
Reaktivitäten Human (16), Maus (7), Ratte (Rattus) (7), Rind (Kuh) (2), Hund (2), Huhn (1), Fruchtfliege (Drosophila melanogaster) (1)
Applikationen Western Blot (WB) (11), Immunfluoreszenz (IF) (6), Durchflusszytometrie (FACS) (5), Enzyme Immunoassay (EIA) (2), ELISA (1), ELISA (Detektionsantikörper) (1)
Konjugate Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), PE,Cy5.5 (1)