SLIT1 Antikörper

Produktnummer ABIN633869

Der Kaninchen Polyklonal anti-SLIT1 Antikörper wird verwendet zum Nachweis von SLIT1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SLIT1 Antikörper (ABIN633869)

Target: SLIT1 (Slit Homolog 1 (SLIT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLIT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLIT1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLIT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLIT1 Blocking Peptide, (ABIN938542), is also available for use as a blocking control in assays to test for specificity of this SLIT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLIT1

Target: SLIT1 (Slit Homolog 1 (SLIT1))

Andere Bezeichnung: SLIT1

Hintergrund: SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors.

Molekulargewicht: 168 kDa (MW of target protein)

Pathways: Regulation of Cell Size