In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Nestin (NES) Antikörper

Antigen

Nestin (NES)
Synonyme FLJ21841, Nbla00170, C78523, ESTM46, AA166324, NES, paranemin
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen
Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN633803
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung
Anwendungen Alternativen Sekundärantikörper Varianten zurück nach oben

Weitere Bezeichnung Nestin
Immunogen Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
Beschreibung Nestin is an intermediate filament protein. It is expressed predominantly in stem cells of the central nervous system in the neural tube.
Molekulargewicht 177 kDa (MW of target protein)

Anwendungen
Alternativen Sekundärantikörper Varianten zurück nach oben

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NES antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Angiogenese, Abstammungsmarker

Alternativen
Anwendungen Sekundärantikörper Varianten zurück nach oben

Alternativen zu Antigen "Nestin (NES)", Typ "Antikörper" finden
Wirte Kaninchen (80), Maus (30), Huhn (3), Ziege (1)
Reaktivitäten Human (87), Maus (37), Ratte (Rattus) (33), Rind (Kuh) (7), Kaninchen (7), Hund (6), Pferd (4), Schwein (4), Hamster (2), Huhn (1), Schimpanse (1), Affe (1), Schaf (1)
Applikationen Western Blot (WB) (70), Immunfluoreszenz (IF) (61), Durchflusszytometrie (FACS) (50), Immunhistochemie (Paraffinschnitte) (IHC (p)) (36), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (24), Immunpräzipitation (IP) (13), ELISA (12), Immunhistochemie (IHC) (11), Enzyme Immunoassay (EIA) (10), Immunzytochemie (ICC) (5), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (4), Immunoelectron Microscopy (IEM) (2)
Konjugate Biotin (4), HRP (4), Alexa Flour 488 (2), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2), RBITC (2)
Epitope C-Term (4), AA 1484-1500 (1), AA 544-776 (1)