KCNK1 Antikörper (Middle Region)

Produktnummer ABIN633793

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch KCNK1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für KCNK1 Antikörper (Middle Region) (ABIN633793)

Target: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNK1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KCNK1 antibody was raised against the middle region of KCNK1

Aufreinigung: Affinity purified

Immunogen: KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK1 Blocking Peptide, (ABIN937712), is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK1

Target: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Andere Bezeichnung: KCNK1

Hintergrund: KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Molekulargewicht: 38 kDa (MW of target protein)