TRPM5 Antikörper (N-Term)

Produktnummer ABIN633719

Der Kaninchen Polyklonal anti-TRPM5 Antikörper wird verwendet zum Nachweis von TRPM5 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für TRPM5 Antikörper (N-Term) (ABIN633719)

Target: TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPM5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRPM5 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRPM5 antibody was raised against the N terminal of TRPM5

Aufreinigung: Affinity purified

Immunogen: TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPM5 Blocking Peptide, (ABIN937891), is also available for use as a blocking control in assays to test for specificity of this TRPM5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPM5

Target: TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))

Andere Bezeichnung: TRPM5

Hintergrund: TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.

Molekulargewicht: 131 kDa (MW of target protein)