P2RX6 Antikörper (N-Term)

Produktnummer ABIN633714

Der Kaninchen Polyklonal anti-P2RX6 Antikörper (ABIN633714) detektiert spezifisch P2RX6 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für P2RX6 Antikörper (N-Term) (ABIN633714)

Target: P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P2RX6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-P2RX6 Antikörper

Bindungsspezifität: N-Term

Spezifität: P2 RXL1 antibody was raised against the N terminal of P2 XL1

Aufreinigung: Affinity purified

Immunogen: P2 RXL1 antibody was raised using the N terminal of P2 XL1 corresponding to a region with amino acids ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

P2RXL1 Blocking Peptide, (ABIN938074), is also available for use as a blocking control in assays to test for specificity of this P2RXL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 XL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P2RX6

Target: P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))

Andere Bezeichnung: P2RXL1

Hintergrund: P2RXL1 encodes a protein in the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. P2RXL1 is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells.

Molekulargewicht: 47 kDa (MW of target protein)