P2RX7 Antikörper (Middle Region)

Produktnummer ABIN633670

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch P2RX7 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für P2RX7 Antikörper (Middle Region) (ABIN633670)

Target: P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P2RX7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-P2RX7 Antikörper

Bindungsspezifität: Middle Region

Spezifität: P2 RX7 antibody was raised against the middle region of P2 X7

Aufreinigung: Affinity purified

Immunogen: P2 RX7 antibody was raised using the middle region of P2 X7 corresponding to a region with amino acids VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

P2RX7 Blocking Peptide, (ABIN5615169), is also available for use as a blocking control in assays to test for specificity of this P2RX7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P2RX7

Target: P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))

Andere Bezeichnung: P2RX7

Hintergrund: The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis