CCT8L2 Antikörper

Produktnummer ABIN633635

Der Kaninchen Polyklonal anti-CCT8L2 Antikörper wird verwendet zum Nachweis von CCT8L2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CCT8L2 Antikörper (ABIN633635)

Target: CCT8L2 (Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCT8L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCT8L2 Antikörper

Aufreinigung: Affinity purified

Immunogen: CCT8 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCT8L2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CCT8L2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCT8L2

Target: CCT8L2 (Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2))

Andere Bezeichnung: CCT8L2

Hintergrund: CCT8L2 belongs to the TCP-1 chaperonin family. It possible molecular chaperone and assists the folding of proteins upon ATP hydrolysis.

Molekulargewicht: 59 kDa (MW of target protein)