VDAC2 Antikörper (N-Term)

Produktnummer ABIN633625

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch VDAC2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für VDAC2 Antikörper (N-Term) (ABIN633625)

Target: VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VDAC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VDAC2 Antikörper

Bindungsspezifität: N-Term

Spezifität: VDAC2 antibody was raised against the N terminal of VDAC2

Aufreinigung: Affinity purified

Immunogen: VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VDAC2 Blocking Peptide, (ABIN5616955), is also available for use as a blocking control in assays to test for specificity of this VDAC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VDAC2

Target: VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))

Andere Bezeichnung: VDAC2

Hintergrund: VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.

Molekulargewicht: 31 kDa (MW of target protein)