In den Warenkorb
Bestellen Sie auch über:
 |
+49 (0)241 95 163 153 |
 |
+49 (0)241 95 163 155 |
A Kinase (PRKA) Anchor Protein 1 (AKAP1) Antikörper
| Antigen | A Kinase (PRKA) Anchor Protein 1 (AKAP1) |
| Synonyme | AKAP, PRKA1, AKAP84, AKAP121, AKAP149, D-AKAP1, MGC1807, SAKAP84, Akap, C76494, C81186, DAKAP1, S-AKAP84, AKAP1, akap1, fa08b04, MGC162884, wu:fa08b04, Akap84 |
| Klonalität | Polyklonal |
| Wirt |
 Alternativen Kaninchen |
| Applikation |
Alternativen Western Blot (WB)
|
| Produktnummer | ABIN633600 |
| Menge | 50 ug (1 mg/ml) (Varianten) |
| Preis | 432,69 € Zzgl. Versandkosten €20,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Lieferung in 5 bis 7 Werktagen |
Produktbeschreibung
| Weitere Bezeichnung | AKAP1 |
| Immunogen | AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF |
| Beschreibung | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. |
| Molekulargewicht | 65 kDa (MW of target protein) |
Anwendungen
| Konzentration | 1 mg/ml |
| Reinigung | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKAP1 antibody in PBS |
| Lagerung | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Forschungsgebiet | Signaltransduktion |
Alternativen
Alternativen zu Antigen "A Kinase (PRKA) Anchor Protein 1 (AKAP1)", Typ "Antikörper" finden
| Wirte | Kaninchen (9), Maus (3) |
| Reaktivitäten | Human (12) |
| Applikationen | Western Blot (WB) (11), Immunfluoreszenz (IF) (4), ELISA (2), ELISA (Detektionsantikörper) (2), Immunhistochemie (IHC) (2), Enzyme Immunoassay (EIA) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1) |
| Epitope | AA 113-270 (1) |
