N-Ethylmaleimide-Sensitive Factor (NSF) Antikörper

Antigen: N-Ethylmaleimide-Sensitive Factor (NSF)

Synonyme: SKD2, NSF, MGC139541, nsf, MGC145265, 18.m06598, DKFZp459E222

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN633516

Produktbeschreibung

Weitere Bezeichnung: NSF

Immunogen: NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL

Beschreibung: NSF is required for vesicle-mediated transport. NSF catalyzes the fusion of transport vesicles within the Golgi cisternae. It is s also required for transport from the endoplasmic reticulum to the Golgi stack. NSF seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.

Molekulargewicht: 33 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NSF antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Signaltransduktion, Metabolismus